Cat: PA2000-2968

Recombinant E.coli luxS Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    luxS

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    luxS;ytjB;S-ribosylhomocysteine lyase

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    C4ZYT7

  • Expression Region

    1-171aa

  • AA Sequence

    MPLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPNKEVMPERGIHTLEHLFAGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMEDVLKVQDQNQIPELNVYQCGTYQMHSLQEAQDIARSILERDVRINSNEELALPKEKLQELHI

  • Molecular Weight

    26.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LuxS is a key enzyme involved in the synthesis of autoinducer-2 (AI-2), a signaling molecule that plays a crucial role in bacterial quorum sensing—a process through which bacteria communicate and coordinate their behavior based on population density. The LuxS gene is widely distributed among various bacteria, including both Gram-positive and Gram-negative species, and is implicated in a range of physiological processes such as biofilm formation, virulence, and antibiotic resistance. Research into LuxS and its recombinant protein has gained significant attention due to its potential applications in understanding bacterial social behavior and developing novel antimicrobial strategies. Recombination allows for the expression and purification of LuxS in heterologous systems, enabling detailed biochemical characterization and functional studies. Furthermore, the exploration of LuxS's structure and function could provide insights into the mechanisms of quorum sensing and its evolutionary significance in microbial communities. Investigating LuxS and its role in signaling pathways can shed light on how bacteria adapt to environmental changes, coordinate group behaviors, and contribute to complex microbial ecosystems. Overall, the study of LuxS recombination proteins represents a promising avenue for elucidating fundamental bacterial communication processes and developing innovative therapeutic approaches to combat bacterial infections.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US