Analytical Data
-
Gene name
RUSC1
- Application
-
Alternative Names
RUSC1; NESCARUN and SH3 domain-containing protein 1; New molecule containing SH3 at the carboxy-terminus; Nesca
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BVN2
-
Expression Region
1-433 aa
-
AA Sequence
MAEAQSGTGQLQEQKKGLLIAVSVSVDKIISHFGAARNLVQKAQLGDSRLSPDVGHLVLTTLCPALHALVADGLKPFRKDLITGQRRSSPWSVVEASVKPGSSTRSLGTLYSQVSRLAPLSSSRSRFHAFILGLLNTKQLELWFSSLQEDAGLLSLLYLPTGFFSLARGGCPSLSTELLLLLQPLSVLTFHLDLLFEHHHHLPLGPPQAPAPPGPPPALQQTMQAMLHFGGRLAQSLRGTSKEAASDPSDSPNLPTPGSWWEQLTQASRVYASGGTEGFPLSRWAPGRHGTAAEEGAQERPLPTDEMAPGRGLWLGRLFGVPGGPAENENGALKSRRPSSWLPPTVSVLALVKRGAPPEMPSPQELEASAPRMVQTHRAVRALCDHTAARPDQLSFRRGEVLRVITTVDEDWLRCGRDGMEGLVPVGYTSLVL
-
Molecular Weight
73 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RUSC1, also known as Rho GTPase-activating protein 1, is a critical regulator of Rho GTPases, which are pivotal in various cellular processes, including cytoskeletal dynamics, cell migration, and proliferation. The protein functions by promoting the conversion of Rho GTPases from their active GTP-bound form to the inactive GDP-bound form, thereby influencing signal transduction pathways. Research on RUSC1 has garnered interest due to its potential implications in cancer, where dysregulation of Rho GTPase activity is often linked to tumor progression and metastasis. Moreover, RUSC1's involvement in modulating cellular responses to stress and its possible interplay with other signaling molecules make it a candidate for therapeutic targeting. Studies have shown that RUSC1 expression levels can correlate with disease severity, highlighting its role as a potential biomarker. The cloning, expression, and purification of recombinant RUSC1 serve as a foundation for further functional studies aimed at elucidating its mechanisms in cellular signaling and its interactions with other proteins. Understanding the structure-function relationships of RUSC1 can pave the way for developing novel therapeutic strategies directed at manipulating Rho GTPase signaling in various diseases. Thus, continued investigation into RUSC1's role within the cellular context remains critical for expanding our knowledge of its contribution to cellular physiology and pathology.
