Analytical Data
-
Gene name
CDS2
- Application
-
Alternative Names
CDS2; Phosphatidate cytidylyltransferase 2; CDP-DAG synthase 2; CDP-DG synthase 2; CDP-diacylglycerol synthase 2; CDS 2; CDP-diglyceride pyrophosphorylase 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95674
-
Expression Region
1-445aa
-
AA Sequence
MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMIIVMCVQIKCFHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLIGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSVIGWKTVRMYPFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQQLHIFNTLRSHLIDKGMLTSTTEDE
-
Molecular Weight
77.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CDS2, or the cytosolic double-stranded RNA (dsRNA)-binding protein, plays a crucial role in the cellular response to viral infections and the regulation of gene expression. The understanding of CDS2 and its functions has gained significant attention in recent years, particularly due to its involvement in innate immunity. Research has shown that CDS2 is essential for recognizing and binding to viral dsRNA, leading to the activation of signaling pathways that trigger an antiviral response. This makes CDS2 a potential target for therapeutic strategies against viral diseases. Additionally, its role in cellular stress responses and apoptosis has spawned interest in its implications for cancer research. The recombinant production of CDS2 allows for detailed structural and functional studies, facilitating the investigation of its interactions with other proteins and RNA. Understanding the mechanistic functions of CDS2 can provide insights into its role in various diseases, opening avenues for novel treatment approaches, especially in the context of viral infections and cancer. As such, the study of CDS2's recombinant protein not only fosters a deeper comprehension of its biological significance but also contributes to the broader field of molecular medicine.
