Analytical Data
-
Gene name
CDKL5
- Application
-
Alternative Names
Cdkl5; CDKL5_HUMAN; Cyclin dependent kinase 5 transcript; Cyclin-dependent kinase-like 5; EIEE2; ISSX; Serine/threonine kinase 9; Serine/threonine-Protein kinase 9; Stk9
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O76039
-
Expression Region
722-831aa
-
AA Sequence
RPDNSFHENNVSTRVSSLPSESSSGTNHSKRQPAFDPWKSPENISHSEQLKEKEKQGFFRSMKKKKKKSQTVPNSDSPDLLTLQKSIHSASTPSSRPKEWRPEKISDLQT
-
Molecular Weight
37.73 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CDKL5 (Cyclin-Dependent Kinase-Like 5) is a serine/threonine kinase that plays a crucial role in neuronal development and synaptic function. Mutations in the CDKL5 gene are linked to CDKL5 deficiency disorder (CDD), a severe form of neurodevelopmental disorder characterized by intractable epilepsy, intellectual disability, and developmental delays, primarily affecting females. Research on CDKL5 recombinant protein has gained significant attention due to its potential in elucidating the molecular mechanisms underlying CDD and exploring therapeutic avenues. The recombinant protein can be used to study the kinase's role in cellular signaling pathways, interactions with other proteins, and effects on neuronal maturation. Additionally, characterizing CDKL5's enzymatic activity and its substrates can provide insights into how its dysfunction leads to the phenotypic manifestations of CDD. The development of animal models expressing CDKL5 mutations further facilitates the assessment of potential interventions, including gene therapy and pharmacological strategies aimed at rescuing the loss of CDKL5 function. Overall, the study of CDKL5 recombinant protein is pivotal in advancing our understanding of CDD and developing targeted treatments for affected individuals.
