Analytical Data
-
Gene name
CYND1
- Application
-
Alternative Names
CYND1;Major pollen allergen Cyn d 1
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O04701
-
Expression Region
1-246aa
-
AA Sequence
AIGDKPGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKP PFDGMTACGNEPIFKDGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEH IAAYHFDLSGKAFGAMAKKGQEDKLRKAGELTLQFRRVKCKYPSGTKITF HIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSDEFIPMKSSWGAIWRI DPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQFGA
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CYND1, a member of the cyclin family of proteins, plays a crucial role in cell cycle regulation and various cellular processes. Research into CYND1 has gained traction due to its potential implications in cancer biology and other diseases associated with abnormal cell proliferation. Initial studies have indicated that CYND1 may function as a regulatory factor that influences the progression of the cell cycle, particularly in the transition from the G1 phase to the S phase, which is critical for DNA replication and cell division. The modulation of CYND1 activity has been linked to various signaling pathways that can affect tumor growth, making it a potential target for therapeutic interventions. Furthermore, recombinant CYND1 protein has become an essential tool for studying its biological functions and interactions with other cellular proteins. Biochemical assays and structural analyses of the recombinant CYND1 have provided insights into its mechanism of action, which can reveal novel strategies for cancer treatment. By understanding the multifaceted roles of CYND1, researchers aim to unravel its contributions to disease mechanisms, paving the way for the development of innovative cancer therapies that could enhance patient outcomes.











