Cat: PA1000-6522

Recombinant Human FLRT1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FLRT1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FLRT1;Leucine-rich repeat transmembrane Protein FLRT1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NZU1

  • Expression Region

    21-524aa

  • AA Sequence

    IDSTTCPSVCRCDNGFIYCNDRGLTSIPADIPDDATTLYLQNNQINNAGI PQDLKTKVNVQVIYLYENDLDEFPINLPRSLRELHLQDNNVRTIARDSLA RIPLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHLSSIPSGLPH TLEELRLDDNRISTIPLHAFKGLNSLRRLVLDGNLLANQRIADDTFSRLQ NLTELSLVRNSLAAPPLNLPSAHLQKLYLQDNAISHIPYNTLAKMRELER LDLSNNNLTTLPRGLFDDLGNLAQLLLRNNPWFCGCNLMWLRDWVKARAA VVNVRGLMCQGPEKVRGMAIKDITSEMDECFETGPQGGVANAAAKTTASN HASATTPQGSLFTLKAKRPGLRLPDSNIDYPMATGDGAKTLAIHVKALTA DSIRITWKATLPASSFRLSWLRLGHSPAVGSITETLVQGDKTEYLLTALE PKSTYIICMVTMETSNAYVADETPVCAKAETADSYGPTTTLNQEQNAGPM ASLP

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FLRT1 (Fibronectin Leucine-rich Transmembrane Protein 1) is a member of the FLRT family of cell adhesion molecules, which play crucial roles in various biological processes, including neural development, cell migration, and tissue integrity. Research on FLRT1 has gained traction due to its involvement in the regulation of cell-to-cell interactions and its implications in developmental disorders and cancer. It has been identified as having significant effects on cellular behaviors such as proliferation and differentiation, making it a potential target for therapeutic interventions. Studies have shown that FLRT1 interacts with various signaling pathways, influencing cellular responses to environmental cues. Moreover, its distinctive structure, characterized by fibronectin type III repeats and a single transmembrane domain, allows it to interact with both extracellular matrix components and intracellular signaling molecules. Understanding the functional dynamics of FLRT1, including its role in cell adhesion and migration, is essential for elucidating its contributions to normal physiology and disease. As a result, recombinant FLRT1 proteins are increasingly utilized in laboratory studies to probe its molecular function, investigate its potential as a biomarker, and explore therapeutic applications in regenerative medicine and oncology. The research into FLRT1 not only enhances our knowledge of cellular mechanisms but also paves the way for innovative strategies in treating diseases associated with dysregulated cell adhesion and signaling.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US