Cat: PA2000-2944

Recombinant Sulfolobus creN7 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    creN7

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    creN7;Chromatin Protein Cren7

  • Species

    Sulfolobus

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    C3MPN0

  • Expression Region

    1-60aa

  • AA Sequence

    MSSGKKAVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI

  • Molecular Weight

    33.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of creN7 recombinant protein has emerged as a significant area of interest in molecular biology and biotechnology due to its potential applications in vaccine development and therapeutic interventions. CreN7 is a specific protein derived from the cre locus of bacteriophage, which plays crucial roles in genetic recombination and gene regulation. Understanding its structure and function can provide insights into viral DNA mechanics and host interactions, paving the way for innovative approaches in combating viral infections. Recent advances in recombinant DNA technology have enabled the efficient production of creN7, facilitating detailed studies on its biochemical properties. Researchers are particularly focused on elucidating its role in promoting genetic diversity among viral populations, and how this could lead to the emergence of new viral strains. Moreover, the potential of creN7 as a target for antiviral drugs further highlights its importance in public health. The exploration of creN7 not only contributes to our understanding of viral biology but also holds promise for the development of novel therapeutic strategies aimed at controlling viral diseases. Thus, the research surrounding creN7 recombinant protein represents a crucial intersection of virology, molecular genetics, and therapeutic innovation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US