Analytical Data
-
Gene name
creN7
- Application
-
Alternative Names
creN7;Chromatin Protein Cren7
-
Species
Sulfolobus
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
C3MPN0
-
Expression Region
1-60aa
-
AA Sequence
MSSGKKAVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI
-
Molecular Weight
33.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of creN7 recombinant protein has emerged as a significant area of interest in molecular biology and biotechnology due to its potential applications in vaccine development and therapeutic interventions. CreN7 is a specific protein derived from the cre locus of bacteriophage, which plays crucial roles in genetic recombination and gene regulation. Understanding its structure and function can provide insights into viral DNA mechanics and host interactions, paving the way for innovative approaches in combating viral infections. Recent advances in recombinant DNA technology have enabled the efficient production of creN7, facilitating detailed studies on its biochemical properties. Researchers are particularly focused on elucidating its role in promoting genetic diversity among viral populations, and how this could lead to the emergence of new viral strains. Moreover, the potential of creN7 as a target for antiviral drugs further highlights its importance in public health. The exploration of creN7 not only contributes to our understanding of viral biology but also holds promise for the development of novel therapeutic strategies aimed at controlling viral diseases. Thus, the research surrounding creN7 recombinant protein represents a crucial intersection of virology, molecular genetics, and therapeutic innovation.











