Analytical Data
-
Gene name
CDIPT
- Application
-
Alternative Names
CDIPT; PIS; PIS1; CDP-diacylglycerol--inositol 3-phosphatidyltransferase; Phosphatidylinositol synthase; PI synthase; PtdIns synthase
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14735
-
Expression Region
1-213aa
-
AA Sequence
MPDENIFLFVPNLIGYARIVFAIISFYFMPCCPLTASSFYLLSGLLDAFDGHAARALNQGTRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMGLWVTAPIALLKSLISVIHLITAARNMAALDAADRAKKK
-
Molecular Weight
49.17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CDIPT (CDP-diacylglycerol-inositol-3-phosphate transferase) is an enzyme that plays a vital role in the biosynthesis of important phospholipids in cellular membranes. It catalyzes the transfer of a phosphatidyl group from CDP-diacylglycerol to inositol, forming phosphatidylinositol, a crucial component in various signaling pathways and membrane dynamics. The study of CDIPT is significant due to its involvement in cellular processes such as signal transduction, membrane trafficking, and cell growth. Dysregulation or mutations in CDIPT have been implicated in several diseases, including cancer and neurological disorders, making it a potential therapeutic target. Recent research efforts have focused on characterizing the structure and function of CDIPT, investigating its enzymatic mechanisms, and exploring how it interacts with other cellular components. By developing recombinant forms of the protein, scientists aim to facilitate high-throughput assays for drug screening and to gain insights into the enzyme's catalytic mechanism. Understanding the biochemical properties and regulatory mechanisms of CDIPT can provide valuable information for the development of novel therapeutic strategies aimed at treating diseases associated with phospholipid metabolism.
