Analytical Data
-
Gene name
alkB
- Application
-
Alternative Names
alkB；ABH6；Alpha-ketoglutarate-dependent dioxygenase alkB homolog 6
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P05050
-
Expression Region
1-216aa
-
AA Sequence
MLDLFADAEPWQEPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGKKE
-
Molecular Weight
44.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AlkB, a member of the α-ketoglutarate-dependent dioxygenase family, plays a crucial role in the repair of damaged DNA through its oxidative demethylation activity. This enzyme has garnered significant interest due to its ability to reverse alkylation damage—specifically targeting methyl groups on DNA bases, which can result from environmental toxins and certain chemotherapeutic agents. The accumulation of such lesions is linked to various diseases, including cancer, making AlkB an attractive target for therapeutic research. Additionally, understanding the structure-function relationship of AlkB can provide insights into its catalytic mechanism and specificity. The recombinant expression of AlkB in various host systems, such as E. coli, allows for the production of large quantities of the protein for biochemical studies and structural analysis. This research can not only enhance our fundamental understanding of DNA repair mechanisms but also pave the way for the development of novel strategies to enhance DNA repair in therapeutic contexts, highlighting the significance of AlkB in both basic and applied biological research.
