Analytical Data
-
Gene name
ghrA
- Application
-
Alternative Names
ghrA；ycdW；Glyoxylate/hydroxypyruvate reductase A
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
B7LFE3
-
Expression Region
1-312aa
-
AA Sequence
MDIIFYHPTFDTQWWIEALRKAIPQARVRAWKSGDNDSADYALVWHPPVEMLAGRDLKAVFALGAGVDSILSKLQAHPEMLNPSVPLFRLEDTGMGEQMQEYAVSQVLHWFRRFDDYRIQQNSSHWQPLPEYHREDFTIGILGAGVLGSKVAQSLQTWRFPLRCWSRTRKSWPGVQSFAGREELSAFLSQCRVLINLLPNTPETVGIINQQLLEKLPDGAYLLNLARGVHVVEDDLLAALDSGKVKGAMLDVFNREPLPPENPLWQHPRVTITPHVAAITRPAEAVEYISRTIAQLEKGERVCGQVDRARGY
-
Molecular Weight
51.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of the ghrA gene, which encodes the growth hormone receptor, has garnered significant attention in the field of molecular biology and endocrinology due to its crucial role in growth regulation and metabolic processes. Abnormalities in the ghrA gene can lead to various growth disorders, including dwarfism and other endocrine dysfunctions. Researchers have focused on the recombinant expression of ghrA protein to better understand its structure, function, and interactions with growth hormone and other signaling pathways. By producing recombinant ghrA protein in host systems such as bacteria or yeast, scientists can investigate its biological activity, develop assays for potential therapeutic applications, and explore its role in growth-related conditions. Furthermore, studying the recombinant ghrA protein facilitates the elucidation of the mechanisms underlying growth hormone signaling, paving the way for potential interventions in growth-related disorders. The advancement of recombinant DNA technology has enabled the detailed investigation of ghrA, providing insights that could lead to innovative treatments for patients suffering from growth-related abnormalities. Overall, the research on ghrA recombinant protein stands as a promising avenue for enhancing our understanding of growth regulation and developing therapeutic strategies for associated pathologies.
