Analytical Data
-
Gene name
CDC91L1
- Application
-
Alternative Names
5430426F17Rik; BC028278; Cdc91l1; Cell division cycle 91 like 1 Protein; Cell division cycle Protein 91-like 1; GAB1; GPI transamidase component PIG-U; GPI transamidase subunit; Phosphatidylinositol glycan anchor biosynthesis class U
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H490
-
Expression Region
1-435aa
-
AA Sequence
MAAPLVLVLVVAVTVRAALFRSSLAEFISERVEVVSPLSSWKRVVEGLSLLDLGVSPYSGAVFHETPLIIYLFHFLIDYAELVFMITDALTAIALYFAIQDFNKVVFKKQKLLLELDQYAPDVAELIRTPMEMRYIPLKVALFYLLNPYTILSCVAKSTCAINNTLIAFFILTTIKGSAFLSAIFLALATYQSLYPLTLFVPGLLYLLQRQYIPVKMKSKAFWIFSWEYAMMYVGSLVVIICLSFFLLSSWDFIPAVYGFILSVPDLTPNIGLFWYFFAEMFEHFSLFFVCVFQINVFFYTIPLAIKLKEHPIFFMFIQIAVIAIFKSYPTVGDVALYMAFFPVWNHLYRFLRNIFVLTCIIIVCSLLFPVLWHLWIYAGSANSNFFYAITLTFNVGQILLISDYFYAFLRREYYLTHGLYLTAKDGTEAMLVLK
-
Molecular Weight
50 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CDC91L1, also known as CDC91 like 1, is a gene that has gained attention in recent years due to its potential role in cellular processes, particularly in the immune response and cell cycle regulation. It is a member of the CDC91 family, which is involved in various biological functions, including the regulation of cell proliferation and differentiation. Research into CDC91L1 has revealed its significant involvement in both normal physiological processes and pathological conditions, such as cancer and autoimmune diseases. The recombinant protein of CDC91L1 has been developed to investigate its structural and functional properties, as well as its interactions with other proteins. Through studies using this recombinant protein, scientists aim to elucidate the molecular mechanisms underlying CDC91L1's functions, which could lead to novel therapeutic strategies for diseases where this gene is implicated. Understanding the role of CDC91L1 at the protein level is crucial for mapping its contribution to cellular dynamics and could provide insights into the development of targeted therapies. Overall, CDC91L1 research, particularly through the study of its recombinant protein, holds promise for advancing our knowledge of fundamental biological processes and developing new interventions for related diseases.
