Analytical Data
-
Gene name
KMT5A
- Application
-
Alternative Names
KMT5A；PRSET7；SET07；SET8；N-lysine methyltransferase KMT5A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NQR1-2
-
Expression Region
195-352aa
-
AA Sequence
KAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVE YHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLG RLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASI EAHPWLKH
-
Molecular Weight
44 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KMT5A, or Lysine Methyltransferase 5A, is a member of the lysine methyltransferase family known for its role in epigenetic regulation through the methylation of lysine residues on histone proteins. This modification plays a critical part in various cellular processes, including gene expression regulation, DNA repair, and cellular differentiation. Research on KMT5A has gained attention due to its potential implications in cancer biology, where aberrant methylation patterns are often associated with tumorigenesis and cancer progression. Dysregulation of KMT5A expression has been linked to several types of cancer, suggesting that it may serve as a therapeutic target or a biomarker for cancer diagnosis and prognosis. In addition, KMT5A's involvement in stem cell biology and developmental processes highlights its significance beyond cancer, making it a key focus for studies exploring epigenetic modifications in health and disease. Understanding KMT5A function and regulation can provide insights into the mechanisms of epigenetic control and lead to the development of novel strategies for disease intervention. Researchers are employing various techniques, including recombinant protein expression, to study KMT5A’s enzymatic activity, substrate specificity, and interaction with other proteins, paving the way for potential applications in targeted therapies and precision medicine.
