Analytical Data
-
Gene name
TIMD4
- Application
-
Alternative Names
TIMD4；TIM4；T-cell immunoglobulin and mucin domain-containing Protein 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96H15
-
Expression Region
25-315aa
-
AA Sequence
ETVVTEVLGHRVTLPCLYSSWSHNSNSMCWGKDQCPYSGCKEALIRTDGM RVTSRKSAKYRLQGTIPRGDVSLTILNPSESDSGVYCCRIEVPGWFNDVK INVRLNLQRASTTTHRTATTTTRRTTTTSPTTTRQMTTTPAALPTTVVTT PDLTTGTPLQMTTIAVFTTANTCLSLTPSTLPEEATGLLTPEPSKEGPIL TAESETVLPSDSWSSVESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDS VSSPQPGASDTAVPEQNKTTKTGQMDGIPMSMKNEMPISQL
-
Molecular Weight
35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TIMD4, also known as T cell immunoglobulin and mucin domain-containing protein 4, is an important immune checkpoint molecule predominantly expressed on dendritic cells and macrophages. Research into TIMD4 has gained momentum in recent years due to its role in modulating immune responses. TIMD4 serves as a receptor for phosphatidylserine, which is often exposed on the surface of apoptotic cells, thus facilitating the clearance of dead cells and maintaining immune tolerance. This function positions TIMD4 as a critical player in resolving inflammation and preventing autoimmune diseases. Furthermore, TIMD4's engagement in T cell regulation and interaction with various immune cells suggests its potential implications in cancer immunotherapy, where manipulating its activity could enhance anti-tumor immunity. Consequently, recombinant TIMD4 proteins have been generated for studying its biological functions, understanding its mechanisms of action, and exploring therapeutic applications. Researchers have employed these recombinant proteins to investigate TIMD4's signaling pathways and its interaction with ligands in vitro, paving the way for novel treatments targeting immune evasion in cancer and chronic infectious diseases. The ongoing study of TIMD4, particularly through recombinant technologies, offers promising insights into its dual role in immunity: as a mediator of tolerance and as a potential target for enhancing immune responses against malignancies.
