Cat: PA2000-2878

Recombinant E.coli lexA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    lexA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    lexA;exrA;spr;tsl;LexA repressor

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P0A7C2

  • Expression Region

    1-202aa

  • AA Sequence

    MKALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEEEEGLPLVGRVAAGEPLLAQQHIEGHYQVDPSLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRNGDWL

  • Molecular Weight

    38.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The LexA protein, originally identified in Escherichia coli, plays a crucial role in the bacterial SOS response, a cellular mechanism triggered by DNA damage. As a repressor, LexA binds to specific DNA sequences to inhibit the expression of genes involved in DNA repair and recombination. Under stress conditions, such as the presence of harmful agents that damage DNA, LexA undergoes auto-proteolysis, leading to its inactivation and the subsequent activation of SOS genes. This process is essential for bacterial survival in adverse environments. The study of LexA and its regulatory functions provides insights into bacterial adaptability and resistance mechanisms. Additionally, due to its well-defined structure and interaction with DNA and other proteins, LexA has become a valuable model for investigating protein-DNA interactions and protein-protein interactions. Research on LexA has implications beyond microbiology, influencing fields such as synthetic biology, where it is utilized as a genetic switch, and biochemistry, where its mechanisms can inform drug discovery efforts targeting similar pathways in pathogenic organisms. Understanding the molecular details of LexA's function could lead to novel strategies for combating bacterial infections and enhancing our knowledge of cellular stress responses in various organisms. As researchers continue to unravel the complexities of LexA's interactions and regulations, this protein remains a significant focus in the study of microbial genetics and cellular response to DNA damage.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US