Cat: PA1000-6160

Recombinant Human C2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    C2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    C2;C2 domain-containing Protein 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P07910

  • Expression Region

    1-293aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMASNVTNKTDPRSMNSRVFIGNLNTLVVKK SDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVL DINLAAEPKVNRGKAGVKRSAAEMYGSSFDLDYDFQRDYYDRMYSYPARV PPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKGDDL QAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVK KDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEG EDDRDSANGEDDS

  • Molecular Weight

    35 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

C2 recombinant proteins have gained significant attention in biomedical research due to their diverse applications in drug development, vaccine production, and therapeutic protein engineering. The C2 domain, originally identified in certain bacterial toxins and mammalian proteins, plays a crucial role in calcium-dependent membrane interactions and cellular signaling. Researchers have harnessed the unique properties of the C2 domain to create recombinant proteins that can effectively target specific biomolecules or pathways. This is particularly valuable in the development of targeted therapies for various diseases, including cancer and autoimmune disorders. Additionally, C2 recombinant proteins are being explored for their potential in enhancing vaccine efficacy by serving as adjuvants, facilitating stronger immune responses. As techniques in genetic engineering and protein expression continue to advance, the generation of C2 recombinant proteins with enhanced functionality and specificity is becoming increasingly feasible. This progression opens new avenues for innovative therapeutic strategies and diagnostics, marking a significant step forward in the field of molecular biology and medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US