Cat: PA2000-2873

Recombinant E.coli esxA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    esxA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    esxA;Beta-2-microglobulin

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q6GCJ0

  • Expression Region

    1-97aa

  • AA Sequence

    MAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ

  • Molecular Weight

    24.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

EsxA is a small, secreted protein associated with the pathogenicity of various bacteria, particularly mycobacteria, such as Mycobacterium tuberculosis (the causative agent of tuberculosis) and Mycobacterium abscessus. This protein plays a crucial role in the immune response, as it is involved in modulating host defenses and facilitating bacterial survival within the host. The study of EsxA has gained significant attention due to its potential as a target for vaccine development and immunotherapy. Research indicates that EsxA can induce the activation of T cells and the production of pro-inflammatory cytokines, which are essential for effective immune responses. Additionally, EsxA is part of the Esx secretion system, which is critical for the delivery of virulence factors facilitating bacterial invasion and evasion of the host's immune system. Understanding the structure, function, and interactions of EsxA at the molecular level can provide insights into its role in pathogenesis and enable the development of novel therapeutic strategies. Moreover, characterizing recombinant EsxA and its derivatives can enhance our knowledge of its immunogenic properties, paving the way for advancements in diagnostic tools and vaccines against mycobacterial infections. Overall, the exploration of EsxA and its recombinant forms is essential for elucidating underlying mechanisms of bacterial virulence and designing effective interventions to combat mycobacterial diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US