Analytical Data
-
Gene name
CCRK
- Application
-
Alternative Names
CAK kinase p42; CAK-kinase p42; CCRK; CDCH; CDK activating kinase p42; CDK-activating kinase p42; cdk20; CDK20_HUMAN; Cell cycle related kinase
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IZL9
-
Expression Region
1-275aa
-
AA Sequence
MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVVQLKAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATRSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASKLPCLPIHLSCRFLSV
-
Molecular Weight
55.99 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCRK (cell cycle-related kinase) is a serine/threonine kinase involved in regulating cell cycle progression and cellular growth. Research into CCRK has gained traction due to its implications in various biological processes and diseases, particularly cancer. CCRK is thought to play a critical role in tumorigenesis by influencing cell cycle dynamics and promoting uncontrolled cell proliferation. Its overexpression has been observed in several types of cancer, making it a potential target for novel therapeutic strategies. Furthermore, studies have revealed that CCRK interacts with key cell cycle regulators, thereby modulating signaling pathways that govern DNA replication and mitosis. Given its critical functions, the biochemical characterization and detailed understanding of CCRK's structure and function as a recombinant protein have become essential for elucidating its role in cancer biology. This research not only paves the way for potential drug development but also enhances our understanding of cell cycle regulation and its aberrations in malignancies.
