Analytical Data
-
Gene name
SIGLEC6
- Application
-
Alternative Names
SIGLEC6；CD33L；CD33L1；OBBP1；Sialic acid-binding Ig-like lectin 6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43699
-
Expression Region
16-320aa
-
AA Sequence
LLPLLWAGALAQERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYG YWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRD NAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLT CSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTC QVTFPGAGVTMERTIQLNVSYAPQKVAISIFQGNSAAFKILQNTSSLPVL EGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTGVLELPQVGSAEEG DFTCR
-
Molecular Weight
60 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Siglec-6, a member of the sialic acid-binding immunoglobulin-like lectin (Siglec) family, plays a crucial role in the immune system by modulating immune cell responses through its interaction with sialylated ligands. Its expression is primarily found in immune cells such as mast cells, basophils, and certain subsets of dendritic cells and B cells. Recent studies have highlighted the importance of Siglec-6 in various immune-related processes, including cytokine release, cell activation, and regulation of inflammation. The interest in recombinant Siglec-6 proteins has surged due to their potential applications in both therapeutic and diagnostic settings, particularly in the context of autoimmune diseases and cancer. Researchers have been focused on characterizing the structure and function of this protein, exploring its ligand binding properties, and assessing how it can influence immune signaling pathways. Additionally, the development of recombinant forms of Siglec-6 enables a more detailed study of its biological functions and offers a platform for creating specific inhibitors or modulators of its activity. Given that aberrant Siglec-6 expression and function have been linked to various pathologies, including allergies and cancers, investigating recombinant Siglec-6 not only enhances our understanding of immune regulation but also holds promise for novel therapeutic strategies aimed at restoring normal immune function or targeting specific disease states. As ongoing research continues to elucidate the complexities surrounding Siglec-6, its role in immunotherapy and as a biomarker for disease progress remains a focal point, making it a significant area of study in immunology and clinical research.
