Cat: PA1000-6146

Recombinant Human MCSFR Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MCSFR

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MCSFR;

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P07333

  • Expression Region

    20-512aa

  • AA Sequence

    IPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSIL STNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFE DQDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKF IQSQDYQCSALMGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEA AQIVCSASSVDVNFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVD FQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGL NLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTYRHTFTLSLP RLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTFINGSGTLLC AASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYPEVLSQEPFHKVTVQ SLLTVETLEHNQTYECRAHNSVGSGSWAFIPISAGAHTHPPDE

  • Molecular Weight

    55 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MCSFR (Multi-Cytokine Signaling Fusion Receptor) is a recombinant protein that has emerged as a significant focus of study due to its potential role in modulating immune responses and its implications in various therapeutic applications. The background of MCSFR research is rooted in the increasing understanding of the complex interplay between cytokines and the immune system's functionality. Cytokines are critical signaling molecules that influence numerous physiological processes, including inflammation, cell proliferation, and differentiation. Dysregulation of cytokine signaling has been associated with a range of diseases, including autoimmune disorders and cancer. Therefore, developing a soluble receptor like MCSFR that can simultaneously bind to multiple cytokines presents an innovative approach to manipulating these pathways. This multi-targeting strategy allows for more efficient neutralization of pro-inflammatory cytokines, potentially leading to improved therapeutic outcomes. Additionally, research has highlighted the ability of MCSFR to enhance the specificity and efficacy of cytokine blockade, making it a promising candidate for clinical applications. The exploration of MCSFR not only represents a significant advancement in recombinant protein technology but also opens avenues for novel treatments in immunotherapy and beyond. Researchers are actively investigating the biochemical properties, functional mechanisms, and therapeutic potential of MCSFR to pave the way for its use in clinical settings, aiming to address unmet medical needs and improve patient care.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US