Analytical Data
-
Gene name
mpt51
- Application
-
Alternative Names
mpt51；fbpC1；fbpD；mpb51；MPT51/MPB51 antigen
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P9WQN6
-
Expression Region
27-299aa
-
AA Sequence
AEPTAKAAPYENLMVPSPSMGRDIPVAFLAGGPHAVYLLDAFNAGPDVSNWVTAGNAMNTLAGKGISVVAPAGGAYSMYTNWEQDGSKQWDTFLSAELPDWLAANRGLAPGGHAAVGAAQGGYGAMALAAFHPDRFGFAGSMSGFLYPSNTTTNGAIAAGMQQFGGVDTNGMWGAPQLGRWKWHDPWVHASLLAQNNTRVWVWSPTNPGASDPAAMIGQAAEAMGNSRMFYNQYRSVGGHNGHFDFPASGDNGWGSWAPQLGAMSGDIVGAIR
-
Molecular Weight
44.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of the MPT51 recombinant protein is rooted in the increasing need to understand and combat the infectious disease caused by Mycobacterium tuberculosis (Mtb), the bacterium responsible for tuberculosis (TB). MPT51, or M. tuberculosis protein 51, is a significant immunogenic protein that plays a crucial role in the immune response to Mtb infection. Given its ability to induce strong cellular and humoral immune responses, MPT51 has garnered interest as a potential target for vaccine development and diagnostic applications. Research has shown that MPT51 is a highly conserved protein, making it a suitable candidate for diagnostic tests to detect TB infections across different populations. Furthermore, the production of MPT51 in recombinant form allows for detailed studies on its structure, function, and potential use in immunotherapy. With rising global TB incidence and the emergence of drug-resistant strains, elucidating the properties of MPT51 could contribute significantly to advancing public health strategies aimed at controlling and eradicating TB. The ongoing research surrounding this protein underscores its importance in both basic microbiology and applied clinical contexts, potentially leading to novel interventions in the fight against one of the world’s deadliest infectious diseases.
