Analytical Data
-
Gene name
CCNC
- Application
-
Alternative Names
ccnc; CCNC_HUMAN; CycC ; Cyclin C; Cyclin-C; hSRB11; OTTHUMP00000016897; SRB11 homolog
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P24863
-
Expression Region
1-283aa
-
AA Sequence
MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS
-
Molecular Weight
56.87 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCNC (Cyclin C) is a crucial component of the cell cycle regulatory system, primarily known for its role in the regulation of transcription and cellular proliferation. It binds with cyclin-dependent kinases (CDKs) to form complexes that are essential for the progression through specific phases of the cell cycle. Dysregulation of CCNC has been implicated in various cancers, making it a significant focus in cancer research. Recent studies have indicated that CCNC also plays a role in maintaining cellular homeostasis and may influence apoptosis and DNA damage response pathways. The recombinant expression of CCNC protein allows for the detailed study of its structure, function, and interactions within the cell, facilitating the understanding of its mechanistic roles in both normal cell cycle progression and the pathogenesis of cancer. Investigating the properties and dynamics of CCNC in vitro provides vital insights that can contribute to the development of targeted therapeutic strategies aimed at hindering cancer cell proliferation. Additionally, exploring the potential post-translational modifications of the CCNC protein can unravel its multifaceted roles in cellular signaling and metastasis. As such, CCNC stands at the intersection of fundamental biology and clinical application, representing a promising avenue for further research aimed at novel cancer treatment modalities.
