Cat: PA2000-2859

Recombinant Saccharomyces cerevisiae PEP4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PEP4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PEP4;PEP19;Calmodulin regulator Protein PCP4

  • Species

    Saccharomyces cerevisiae

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P07267

  • Expression Region

    77-405aa

  • AA Sequence

    GGHDVPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAIQYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGLGYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGIDESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLITLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGPYDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVGLAKAI

  • Molecular Weight

    48.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PEP4, also known as proteinase A, is a lysosomal enzyme primarily found in yeast and has garnered significant interest in the field of molecular biology due to its role in intracellular protein degradation. This enzyme is pivotal for the maturation of precursor proteins and the turnover of cellular proteins, thereby playing a crucial role in maintaining cellular homeostasis and regulating various metabolic pathways. Research on PEP4 has expanded as scientists explore its potential applications in biotechnology and therapeutic development. For instance, understanding the mechanisms of PEP4 can aid in developing strategies for enhancing protein production in yeast, which is essential for the recombinant protein industry. Furthermore, given its role in degradation pathways, PEP4 is being investigated in the context of various diseases, including neurodegenerative disorders where protein aggregation occurs. The study of PEP4 not only contributes to our fundamental understanding of proteolytic processes in eukaryotic cells but also may lead to advancements in biopharmaceuticals, including improved methods for enzyme production and drug delivery systems. As a model organism, yeasts like Saccharomyces cerevisiae serve as valuable systems for dissecting the function of PEP4 and its regulatory networks, paving the way for further research into its applications in human health and disease management. Thus, the ongoing investigation into PEP4 represents a promising intersection of basic research and applied science, with far-reaching implications across multiple fields.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US