Cat: PA2000-2856

Recombinant Human RAD52 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RAD52

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RAD52;DNA repair Protein RAD52 homolog

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P43351

  • Expression Region

    1-418aa

  • AA Sequence

    MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPE YISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNN GKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDG LKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSV EEARYNSCRPNMALGHPQLQQVTSPSRPSHAVIPADQDCSSRSLSSSAVE SEATHQRKLRQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHST PVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRAD PAQTSDTLALNNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGN WESHRKSQDMKKRKYDPS

  • Molecular Weight

    46 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RAD52 is a crucial DNA recombination protein that plays a significant role in the repair of DNA double-strand breaks (DSBs), a type of damage that can lead to genomic instability and cancer if left unrepaired. Research into RAD52 has gained momentum due to its implications in both fundamental biology and potential therapeutic applications. It acts as a mediator in homologous recombination (HR), a critical repair pathway that utilizes a homologous template to accurately repair DSBs. RAD52 not only promotes the annealing of single-stranded DNA but also facilitates the recruitment and interaction of other essential repair proteins, making it a key player in the DNA damage response. Mutations or dysregulation of RAD52 have been implicated in various cancers, highlighting its potential as a target for novel cancer therapies, particularly in tumors deficient in other repair pathways. Furthermore, understanding the mechanistic details of RAD52 function can provide insights into the broader networks of DNA repair and genome maintenance, paving the way for advancements in targeted therapies and precision medicine. Given its multifaceted roles in cellular processes, RAD52 continues to be a focal point of research, striving to unravel its complex interactions and contributions to genomic stability and disease progression.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US