Analytical Data
-
Gene name
UL83
- Application
-
Alternative Names
UL83;C6orf150;MB21D1;Cyclic GMP-AMP synthase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P06725
-
Expression Region
351-480aa
-
AA Sequence
FDIDLLLQRGPQYSEHPTFTSQYRIQGKLEYRHTWDRHDEGAAQGDDDVWTSGSDSDEELVTTERKTPRVTGGGAMAGASTSAGRKRKSASSATACTSGVMTRGRLKAESTVAPEEDTDEDSDNEIHNPA
-
Molecular Weight
18.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UL83 protein, also known as pp65, is a prominent immediate-early gene product of human cytomegalovirus (HCMV), which is a member of the Herpesviridae family. This protein plays a crucial role in the viral lifecycle, influencing both viral replication and immune evasion. Research into UL83 has garnered significant attention due to its potential as a target for therapeutic interventions and vaccine development against HCMV, a virus that can cause severe complications in immunocompromised individuals and congenital infections in newborns. Studies have shown that UL83 can modulate host immune responses by inhibiting antigen presentation and promoting immune tolerance. Furthermore, the protein can also be utilized as a biomarker for HCMV infection and disease progression. As such, understanding the structure and function of UL83 is pivotal for developing strategies to combat HCMV-related diseases. Recent advances in molecular biology, including genetic engineering and structural biology techniques, have paved the way for in-depth investigations into UL83, enabling researchers to explore its interactions with host cellular machinery and its role in viral pathogenesis. The insights gained from these studies could lead to novel therapeutic approaches that enhance the immune response against HCMV and ultimately improve patient outcomes.











