Analytical Data
-
Gene name
ccmG
- Application
-
Alternative Names
ccmG; Pden_1410Thiol:disulfide interchange Protein DsbE homolog; Cytochrome c biogenesis Protein CcmG
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0AA86
-
Expression Region
26-185aa
-
AA Sequence
MRNAEGDDPTNLESALIGKPVPKFRLESLDNPGQFYQADVLTQGKPVLLNVWATWCPTCRAEHQYLNQLSAQGIRVVGMNYKDDRQKAISWLKELGNPYALSLFDGDGMLGLDLGVYGAPETFLIDGNGIIRYRHAGDLNPRVWEEEIKPLWEKYSKEAAQ
-
Molecular Weight
25.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of the recombinant protein ccmG is rooted in the broader context of understanding the mechanisms of protein folding and maturation within bacterial systems. CcmG (cytochrome c maturation gene) is involved in the maturation of cytochrome c, a crucial component of the electron transport chain, which plays a vital role in cellular respiration and energy production in bacteria. The proper functioning of CcmG is essential for the post-translational modification and import of heme into apocytochrome, facilitating the formation of active cytochrome c. Investigating ccmG, particularly its role and mechanism in this maturation process, can provide insights into cytochrome c biosynthesis and the intricate network of protein interactions in prokaryotic systems. Moreover, recombinant expression of CcmG allows for the study of its properties in a controlled environment, enabling researchers to examine the enzyme's function, regulation, and potential applications in biotechnology. Understanding ccmG's molecular characteristics could pave the way for advancements in metabolic engineering, synthetic biology, and the development of novel biofuels, highlighting the importance of this research in both fundamental biology and applied sciences.
