Analytical Data
-
Gene name
RNF183
- Application
-
Alternative Names
RNF183; E3 ubiquitin-protein ligase RNF183
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96D59
-
Expression Region
1-192 aa
-
AA Sequence
MAEQQGRELEAECPVCWNPFNNTFHTPKMLDCCHSFCVECLAHLSLVTPARRRLLCPLCRQPTVLASGQPVTDLPTDTAMLTLLRLEPHHVILEGHQLCLKDQPKSRYFLRQPRVYTLDLGPQPGGQTGPPPDTASATVSTPILIPSHHSLRECFRNPQFRIFAYLMAVILSVTLLLIFSIFWTKQFLWGVG
-
Molecular Weight
48.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RNF183 is an E3 ubiquitin ligase that plays a crucial role in the regulation of protein degradation and various cellular processes, including apoptosis, cell cycle progression, and immune responses. Its involvement in these pathways has made it a significant focus of research, particularly in the context of cancer and autoimmune diseases. Recent studies have indicated that RNF183 may be implicated in the modulation of signaling pathways associated with tumorigenesis, suggesting that it could serve as a potential biomarker for cancer progression or a target for therapeutic intervention. Additionally, the ability of RNF183 to interact with various substrate proteins highlights its importance in maintaining cellular homeostasis. As a result, the characterization and functional analysis of recombinant RNF183 protein have become essential in understanding its biological roles and mechanisms of action. Researchers are actively investigating its structure, substrate specificity, and regulatory mechanisms to elucidate how RNF183 contributes to disease pathology and to explore its potential applications in targeted therapies. The ongoing efforts to express and purify recombinant RNF183 protein will facilitate the development of assays to study its activity and interactions, paving the way for future breakthroughs in the field of molecular biology and therapeutic development.
