Cat: PA1000-6045

Recombinant Human VNN1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    VNN1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    VNN1;Pantetheinase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O95497

  • Expression Region

    22-490aa

  • AA Sequence

    QDTFTAAVYEHAAILPNATLTPVSREEALALMNRNLDILEGAITSAADQG AHIIVTPEDAIYGWNFNRDSLYPYLEDIPNPEVNWIPCNNRNRFGQTPVQ ERLSCLAKNNSIYVVANIGDKKPCDTSDPQCPPDGRYQYNTDVVFDSQGK LVARYHKQNLFMGENQFNVPKEPEIVTFNTTFGSFGIFTCFDILFHDPAV TLVKDFHVDTIVFPTAWMNVLPHLSAVEFHSAWAMGMRVNFLASNIHYPS KKMTGSGIYAPNSSRAFHYDMKTEEGKLLLSQLDSHPSHSAVVNWTSYAS SIEALSSGNKEFKGTVFFDEFTFVKLTGVAGNYTVCQKDLCCHLSYKMSE NIPNEVYALGAFDGLHTVEGRYYLQICTLLKCKTTNLNTCGDSAETASTR FEMFSLSGTFGTQYVFPEVLLSENQLAPGEFQVSTDGRLFSLKPTSGPVL TVTLFGRLYEKDWASNASSVDHHHHHH

  • Molecular Weight

    53 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

VNN1, or Vanin-1, is a member of the vanin gene family that encodes a pantetheinase enzyme, playing a crucial role in the hydrolysis of pantetheine to pantothenic acid and cysteamine. Research into VNN1 has gained traction due to its pivotal involvement in various physiological processes, such as inflammation, oxidative stress, and cellular metabolism. Notably, VNN1 is expressed in a variety of tissues, including the heart, liver, and immune cells, indicating its potential significance in health and disease. Recent studies have highlighted its association with several pathological conditions, including cancer, neurodegeneration, and cardiovascular diseases, suggesting that VNN1 could serve as a biomarker or therapeutic target. The recombinant VNN1 protein has become a focal point for researchers aiming to elucidate its enzymatic functions and regulatory mechanisms, as well as its potential implications in therapeutic strategies. By employing advanced molecular biology techniques, scientists are exploring the structure-function relationship of VNN1, its interaction with various substrates, and its influence on metabolic pathways, thus paving the way for a deeper understanding of its role in human health and disease management. The implications of VNN1 research extend to drug development and precision medicine, making it a valuable area of investigation in current biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US