Analytical Data
-
Gene name
RNF182
- Application
-
Alternative Names
RING finger protein 182;RING-type E3 ubiquitin transferase RNF182
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N6D2
-
Expression Region
1-183 aa
-
AA Sequence
MASQPPEDTAESQASDELECKICYNRYNLKQRKPKVLECCHRVCAKCLYKIIDFGDSPQGVIVCPFCRFETCLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLLTPKRLASLVSPSHTSSNCLVITIMEVQRESSPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIR
-
Molecular Weight
27.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RNF182 is a member of the RING finger protein family, which is known for their E3 ubiquitin ligase activity, playing a crucial role in post-translational modifications and protein degradation pathways. The significance of RNF182 in cellular processes such as cell cycle regulation, apoptosis, and responses to stress has garnered attention in recent years. Dysregulation of ubiquitination pathways, often involving E3 ligases like RNF182, is linked to various diseases, including cancer and neurodegenerative disorders. Research into RNF182’s function and mechanisms has revealed its potential involvement in critical cellular functions, such as maintaining genome integrity and regulating protein stability. However, the specific substrates and biological pathways associated with RNF182 remain poorly characterized. Investigating recombinant RNF182 proteins allows for the elucidation of its biochemical properties, substrate interactions, and potential therapeutic implications. By studying RNF182 in vitro and in vivo, researchers aim to define its role in cellular regulation and pathology, contributing to a deeper understanding of ubiquitin-mediated signaling and offering insights into novel therapeutic strategies for diseases associated with dysregulated ubiquitin ligases.
