Cat: PA2000-2829

Recombinant E.coli phrB Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    phrB

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    phrB;(6-4) photolyase

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P00914

  • Expression Region

    1-472aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMTTHLVWFRQDLRLHDNLALAAACRNS SARVLALYIATPRQWATHNMSPRQAELINAQLNGLQIALAEKGIPLLFRE VDDFVASVEIVKQVCAENSVTHLFYNYQYEVNERARDVEVERALRNVVCE GFDDSVILPPGAVMTGNHEMYKVFTPFKNAWLKRLREGMPECVAAPKVRS SGSIEPSPSITLNYPRQSFDTAHFPVEEKAAIAQLRQFCQNGAGEYEQQR DFPAVEGTSRLSASLATGGLSPRQCLHRLLAEQPQALDGGAGSVWLNELI WREFYRHLITYHPSLCKHRPFIAWTDRVQWQSNPAHLQAWQEGKTGYPIV DAAMRQLNSTGWMHNRLRMITASFLVKDLLIDWREGERYFMSQLIDGDLA ANNGGWQWAASTGTDAAPYFRIFNPTTQGEKFDHEGEFIRQWLPELRDVP GKVVHEPWKWAQKAGVTLDYPQPIVEHKEARVQTLAAYEAARKGK

  • Molecular Weight

    56 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of the phrB recombinant protein is rooted in its significant role in bacterial communication and environmental adaptation. PhrB is a part of the quorum sensing system in certain bacteria, particularly in species like *Bacillus subtilis*, where it functions as a signaling molecule that regulates gene expression in response to population density. Understanding the structure and function of phrB can provide insights into the mechanisms of bacterial behavior, such as biofilm formation, virulence, and antibiotic resistance. The recombinant production of phrB enables researchers to investigate its biochemical properties and interactions with other cellular components in a controlled laboratory setting. Such studies can reveal how phrB contributes to bacterial survival and adaptability under various stress conditions, offering potential applications in biotechnology and medicine. For instance, modulating the activity of phrB or its pathways may lead to novel strategies for managing bacterial infections or enhancing the efficacy of probiotics. Overall, the investigation of phrB recombinant protein stands at the intersection of microbiology, genetics, and therapeutic development, highlighting its relevance in both fundamental and applied sciences.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US