Cat: PAX2000-10959

Recombinant Human RNF170 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RNF170

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RNF170; E3 ubiquitin-protein ligase RNF170; Putative LAG1-interacting protein; RING finger protein 170; RING-type E3 ubiquitin transferase RNF170

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96K19

  • Expression Region

    1-200 aa

  • AA Sequence

    MAKYQGEVQSLKLDDDSVIEGVSDQVLVAVVVSFALIATLVYALFRNVHQNIHPENQELVRVLREQLQTEQDAPAATRQQFYTDMYCPICLHQASFPVETNCGHLFCGACIIAYWRYGSWLGAISCPICRQTGSSEKSSRASEQTHQEAVACLDTQNSPACTVGCRSGPQHIPHDRMLPSASPRLCFTLLDCVSILWFSG

  • Molecular Weight

    48.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RNF170 is an increasingly studied protein involved in various cellular processes, including protein degradation, signaling pathways, and response to cellular stress. As a member of the RING-type E3 ubiquitin ligase family, RNF170 plays a crucial role in the ubiquitin-proteasome system, which regulates protein turnover and maintains cellular homeostasis. Recent research has highlighted its potential involvement in neurodegenerative diseases and cancer, suggesting that alterations in RNF170 expression or function may contribute to disease progression. Understanding the molecular mechanisms of RNF170's action could provide insights into its role in disease pathology and offer prospects for therapeutic interventions. The development of RNF170 recombinant proteins has facilitated detailed studies of its biochemical properties, interactions with target substrates, and modulation of signaling pathways. These investigations are pivotal for comprehending how RNF170 influences cellular functions and may lead to novel strategies for targeting RNF170 in disease contexts. Overall, research on RNF170 is at the intersection of molecular biology and therapeutic development, highlighting its significance in both fundamental and applied biomedical fields.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US