Analytical Data
-
Gene name
RNF170
- Application
-
Alternative Names
RNF170; E3 ubiquitin-protein ligase RNF170; Putative LAG1-interacting protein; RING finger protein 170; RING-type E3 ubiquitin transferase RNF170
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96K19
-
Expression Region
1-200 aa
-
AA Sequence
MAKYQGEVQSLKLDDDSVIEGVSDQVLVAVVVSFALIATLVYALFRNVHQNIHPENQELVRVLREQLQTEQDAPAATRQQFYTDMYCPICLHQASFPVETNCGHLFCGACIIAYWRYGSWLGAISCPICRQTGSSEKSSRASEQTHQEAVACLDTQNSPACTVGCRSGPQHIPHDRMLPSASPRLCFTLLDCVSILWFSG
-
Molecular Weight
48.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RNF170 is an increasingly studied protein involved in various cellular processes, including protein degradation, signaling pathways, and response to cellular stress. As a member of the RING-type E3 ubiquitin ligase family, RNF170 plays a crucial role in the ubiquitin-proteasome system, which regulates protein turnover and maintains cellular homeostasis. Recent research has highlighted its potential involvement in neurodegenerative diseases and cancer, suggesting that alterations in RNF170 expression or function may contribute to disease progression. Understanding the molecular mechanisms of RNF170's action could provide insights into its role in disease pathology and offer prospects for therapeutic interventions. The development of RNF170 recombinant proteins has facilitated detailed studies of its biochemical properties, interactions with target substrates, and modulation of signaling pathways. These investigations are pivotal for comprehending how RNF170 influences cellular functions and may lead to novel strategies for targeting RNF170 in disease contexts. Overall, research on RNF170 is at the intersection of molecular biology and therapeutic development, highlighting its significance in both fundamental and applied biomedical fields.
