Cat: PA2000-2827

Recombinant Human YPT1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    YPT1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    YPT1;RAB1;Ras-related Protein Rab-1A

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P62820

  • Expression Region

    2-205aa

  • AA Sequence

    SSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC

  • Molecular Weight

    49.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

YPT1, a member of the Rab GTPase family, plays a crucial role in the regulation of intracellular transport and membrane trafficking in eukaryotic cells. It is predominantly involved in vesicle transport processes that are essential for maintaining cellular functions, including endocytosis and exocytosis. Research on YPT1 has gained significant attention due to its implication in numerous cellular pathways and its potential involvement in various diseases, including neurodegenerative disorders and cancer. The recombinant expression of YPT1 protein allows for the study of its biochemical properties, interactions with other proteins, and its role in cellular pathways. By utilizing technologies such as recombinant DNA methods, researchers can produce YPT1 in suitable expression systems, enabling in-depth functional assays and structural studies. Understanding YPT1's mechanisms can lead to insights into its role as a therapeutic target, potentially yielding strategies for modulating its function in disease contexts. The exploration of YPT1 not only enhances our comprehension of cellular logistics but also opens avenues for biotechnology applications, such as drug delivery systems and gene therapy techniques. As the research on YPT1 continues to evolve, it holds promise for innovative approaches in cellular biology, biophysics, and medicine, emphasizing the importance of detailed investigation into its molecular and functional characteristics.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US