Analytical Data
-
Gene name
rbtD
- Application
-
Alternative Names
rbtD;Ribitol 2-dehydrogenase
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P00335
-
Expression Region
1-249aa
-
AA Sequence
MKHSVSSMNTSLSGKVAAITGAASGIGLECARTLLGAGAKVVLIDREGEKLNKLVAELGENAFALQVDLMQADQVDNLLQGILQLTGRLDIFHANAGAYIGGPVAEGDPDVWDRVLHLNINAAFRCVRSVLPHLIAQKSGDIIFTAVIAGVVPVIWEPVYTASKFAVQAFVHTTRRQVAQYGVRVGAVLPGPVVTALLDDWPKAKMDEALANGSLMQPIEVAESVLFMVTRSKNVTVRDIVILPNSVDL
-
Molecular Weight
30.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on rbtD recombinant protein has garnered significant interest due to its potential applications in various fields, particularly in microbiology and biotechnology. rbtD, a gene derived from the bacterium *Rhodococcus sp.*, encodes a protein involved in the biosynthesis of specific metabolites that can be exploited for industrial purposes, such as bioremediation and biofuel production. The protein's unique structural features and enzymatic properties make it a subject of investigation for its role in degrading complex organic compounds. Additionally, understanding rbtD can provide insights into the mechanisms of microbial metabolism and its adaptive strategies in diverse environments. As researchers aim to enhance the efficiency of rbtD through recombinant DNA technology, the study of this protein not only paves the way for innovative applications but also contributes to fundamental knowledge about microbial ecology and enzyme function, thereby bridging the gap between basic and applied science. Furthermore, advancements in rbtD research hold promise for developing sustainable technologies that address environmental challenges, making it a compelling area of study in contemporary biotechnology.











