Analytical Data
-
Gene name
CCDC74A
- Application
-
Alternative Names
CCDC74ACoiled-coil domain-containing Protein 74A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96AQ1
-
Expression Region
1-378aa
-
AA Sequence
MSGAGVAAGTRPPSSPTPGSRRRRQRPSVGVQSLRPQSPQLRQSDPQKRNLDLEKSLQFLQQQHSEMLAKLHEEIEHLKRENKDLHYKLIMNQTSQKKDGPSGNHLSRASAPLGARWVCINGVWVEPGGPSPARLKEGSSRTHRPGGKRGRLAGGSADTVRSPADSLSMSSFQSVKSISNSGKARPQPGSFNKQDSKADVSQKADLEEEPLLHNSKLDKVPGVQGQARKEKAEASNAGAACMGNSQHQGRQMGAGAHPPMILPLPLRKPTTLRQCEVLIRELWNTNLLQTQELRHLKSLLEGSQRPQAAPEEASFPRDQEATHFPKVSTKSLSKKCLSPPVAERAILPALKQTPKNNFAERQKRLQAMQKRRLHRSVL
-
Molecular Weight
68 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCDC74A (Coiled-Coil Domain Containing 74A) is a gene that encodes a protein implicated in various cellular processes, including cell division and signaling pathways. Recent studies have indicated that CCDC74A may play a significant role in the regulation of gene expression and cellular responses to stress, making it a potential biomarker for certain diseases, including cancer. The interest in CCDC74A has surged due to its coiled-coil domain, which suggests a structural role in protein-protein interactions, crucial for cellular functions. Additionally, research has shown that alterations in CCDC74A expression can affect cell proliferation and apoptosis, further highlighting its importance in maintaining cellular homeostasis. Recombination and expression of CCDC74A in various systems, such as yeast or mammalian cells, allow scientists to explore its functional properties in greater detail. Understanding the structure and functionality of CCDC74A through recombinant protein studies may pave the way for novel therapeutic strategies targeting related signaling pathways and cellular processes. The ongoing investigation of CCDC74A's biological role and its potential implications in human health underscores its relevance in molecular biology and biotechnology research.
