Cat: PA1000-6029

Recombinant Human TEM8 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TEM8

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TEM8;ATR;TEM8;Anthrax toxin receptor 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9H6X2-2

  • Expression Region

    1-368aa

  • AA Sequence

    MATAERRALGIGFQWLSLATLVLICAGQGGRREDGGPACYGGFDLYFILD KSGSVLHHWNEIYYFVEQLAHKFISPQLRMSFIVFSTRGTTLMKLTEDRE QIRQGLEELQKVLPGGDTYMHEGFERASEQIYYENRQGYRTASVIIALTD GELHEDLFFYSEREANRSRDLGAIVYCVGVKDFNETQLARIADSKDHVFP VNDGFQALQGIIHSILKKSCIEILAAEPSTICAGESFQVVVRGNGFRHAR NVDRVLCSFKINDSVTLNEKPFSVEDTYLLCPAPILKEVGMKAALQVSMN DGLSFISSSVIITTTHCSDGSILAIALLILFLLLALALLWWFWPLCCTVI IKEVPPPPAEESEENKIK

  • Molecular Weight

    68 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The TEM8 protein, also known as Tumor Endothelial Marker 8, is a receptor that has garnered significant interest in cancer research due to its selective expression in the endothelial cells of tumor vasculature. Unlike normal endothelial cells, TEM8 is predominantly found in the blood vessels of various tumors, making it a potential target for cancer therapies and diagnostics. Research has shown that TEM8 plays a crucial role in tumor angiogenesis, the process by which new blood vessels form from existing ones, thereby supplying nutrients and oxygen to tumors and facilitating their growth and metastasis. The study of TEM8 and its signaling pathways could provide insights into tumor biology and lead to the development of novel therapeutic strategies aimed at hindering tumor progression. Moreover, the exploration of TEM8 as a biomarker for tumor-endothelium provides opportunities for targeted drug delivery and imaging applications in oncology. As such, the ongoing research into the structure and function of TEM8 recombinant proteins holds promise for advancing our understanding of cancer biology and improving treatment options for patients.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US