Analytical Data
-
Gene name
CCDC68
- Application
-
Alternative Names
CCD68_HUMAN; CCDC 68; CCDC68; Coiled coil domain containing 68; Coiled coil domain containing Protein 68; Coiled-coil domain-containing Protein 68; CTCL associated antigen se57 1; CTCL tumor antigen se57 1; CTCL-associated antigen se57-1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H2F9
-
Expression Region
1-335aa
-
AA Sequence
MTTVTVTTEIPPRDKMEDNSALYESTSAHIIEETEYVKKIRTTLQKIRTQMFKDEIRHDSTNHKLDAKHCGNLQQGSDSEMDPSCCSLDLLMKKIKGKDLQLLEMNKENEVLKIKLQASREAGAAALRNVAQRLFENYQTQSEEVRKKQEDSKQLLQVNKLEKEQKLKQHVENLNQVAEKLEEKHSQITELENLVQRMEKEKRTLLERKLSLENKLLQLKSSATYGKSCQDLQREISILQEQISHLQFVIHSQHQNLRSVIQEMEGLKNNLKEQDKRIENLREKVNILEAQNKELKTQVALSSETPRTKVSKAVSTSELKTEGVSPYLMLIRLRK
-
Molecular Weight
65.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCDC68, or coiled-coil domain containing 68, is a protein that has garnered attention in recent years due to its potential roles in cellular processes and disease mechanisms. This protein is primarily known for its involvement in the regulation of chromatin structure and gene expression, contributing to various biological functions. Abnormalities in CCDC68 expression or function have been linked to several diseases, including cancer, where it may influence tumorigenesis and metastasis. Furthermore, CCDC68 has been identified as a potential substrate for post-translational modifications, suggesting its involvement in complex signaling pathways. To better understand its biological roles and implications in disease, researchers have focused on the development and characterization of recombinant CCDC68 protein. This approach allows for the in-depth analysis of its structure, functional interactions with other cellular molecules, and its potential role in drug discovery. By studying the recombinant form, scientists aim to elucidate the mechanisms through which CCDC68 may affect cellular functions and contribute to pathophysiological conditions, ultimately paving the way for targeted therapeutic strategies.
