Cat: PA1000-6002

Recombinant Human APEX1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    APEX1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    APEX1;APE;APE1;APEX;DNA repair nuclease/redox regulator APEX1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P27695

  • Expression Region

    1-318aa

  • AA Sequence

    MASMTGGQQMGRGSMPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKE AAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKE EAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSR QCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQ RWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQE RQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFL LSHSLLPALCDSKIRSKALGSDHCPITLYLAL

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

APEX1 (apurinic/apyrimidinic endonuclease 1) is a crucial enzyme involved in the base excision repair pathway, which is essential for maintaining genomic stability by repairing DNA damage. The importance of APEX1 in cellular processes has garnered significant attention in the fields of molecular biology and cancer research. It plays a dual role as both a DNA repair protein and a redox regulator, influencing various cellular functions, including transcription regulation and response to oxidative stress. Dysregulation of APEX1 has been linked to several diseases, notably cancer, where its overexpression can contribute to tumorigenesis by facilitating the survival of cells with damaged DNA. Consequently, understanding the structural and functional properties of APEX1 has become a focal point for researchers aiming to elucidate its role in cancer biology and other disorders. Recent advancements in recombinant protein technology have paved the way for the production and characterization of APEX1, enabling detailed studies of its enzymatic mechanisms, interaction with other proteins, and the development of potential therapeutic inhibitors. These investigations are crucial not only for understanding the fundamental biology of DNA repair but also for identifying novel targets for cancer treatment and enhancing the effectiveness of existing therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US