Cat: PA2000-2816

Recombinant E.coli nlpD Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    nlpD

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    nlpD;Murein hydrolase activator NlpD

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P0ADA3

  • Expression Region

    26-379aa

  • AA Sequence

    CSDTSNPPAPVSSVNGNAPANTNSGMLITPPPKMGTTSTAQQPQIQPVQQ PQIQATQQPQIQPVQPVAQQPVQMENGRIVYNRQYGNIPKGSYSGSTYTV KKGDTLFYIAWITGNDFRDLAQRNNIQAPYALNVGQTLQVGNASGTPITG GNAITQADAAEQGVVIKPAQNSTVAVASQPTITYSESSGEQSANKMLPNN KPTATTVTAPVTVPTASTTEPTVSSTSTSTPISTWRWPTEGKVIETFGAS EGGNKGIDIAGSKGQAIIATADGRVVYAGNALRGYGNLIIIKHNDDYLSA YAHNDTMLVREQQEVKAGQKIATMGSTGTSSTRLHFEIRYKGKSVNPLRY LPQR

  • Molecular Weight

    54 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The research on NLPD recombinant protein stems from the growing interest in understanding and manipulating neurotoxic peptides for therapeutic purposes. NLPD, a neurotoxin derived from certain venomous organisms, has garnered attention due to its unique structure and potent biological activity. These peptides have the potential for applications in drug development, particularly in treating neurological disorders or as tools for molecular biology. Researchers are focused on recombinant technology to produce NLPD with high purity and yield, which allows for detailed structural and functional studies. This approach not only enables the exploration of NLPD's mechanisms of action but also aids in the identification of potential analogs with improved therapeutic profiles. Additionally, studying NLPD in the context of protein engineering could lead to innovations in biomedicine, enhancing our ability to design targeted interventions for a variety of diseases. The integration of bioinformatics and molecular modeling in this research further contributes to the understanding of NLPD's interactions at the molecular level, paving the way for developing new classes of pharmaceuticals. Overall, the NLPD recombinant protein serves as a promising candidate for advancing both basic research and clinical applications in neuropharmacology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US