Analytical Data
-
Gene name
CD3d
- Application
-
Alternative Names
CD3d；T3D；T-cell surface glycoProtein CD3 delta chain
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P04234
-
Expression Region
22-105aa
-
AA Sequence
FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIY RCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA
-
Molecular Weight
11 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD3d, a crucial component of the T-cell receptor (TCR) complex, plays a significant role in T-cell activation and immune response. Research on CD3d recombinant proteins has gained attention due to their potential applications in immunotherapy, vaccine development, and understanding T-cell biology. The CD3d molecule, part of the CD3 complex, is essential for transmitting activation signals upon T-cell engagement with antigen-presenting cells. Given its pivotal role in the adaptive immune response, manipulating CD3d through recombinant technology can enhance our understanding of T-cell receptor signaling and its implications in various diseases, including cancer and autoimmune disorders. Recent advancements in protein engineering have facilitated the generation of modified CD3d proteins with improved binding affinities and specificities, making them valuable tools for studying T-cell interactions. Furthermore, these recombinant proteins can serve as promising candidates for developing novel therapeutic strategies aimed at modulating T-cell responses. By elucidating the molecular mechanisms underlying CD3d function and its interactions within the TCR complex, researchers aim to uncover novel therapeutic avenues that could enhance immune responses against tumors or restore T-cell function in patients with dysfunctional immune systems. Overall, the study of CD3d recombinant proteins not only deepens our understanding of T-cell biology but also holds great promise for the advancement of immunotherapeutic approaches in clinical applications.
