Analytical Data
-
Gene name
CCDC121
- Application
-
Alternative Names
CCDC121Coiled-coil domain-containing Protein 121
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6ZUS5
-
Expression Region
1-278aa
-
AA Sequence
MTDLNKHIKQAQTQRKQLLEESRELHREKLLVQAENRFFLEYLTNKTEEYTEQPEKVWNSYLQKSGEIERRRQESASRYAEQISVLKTALLQKENIQSSLKRKLQAMRDIAILKEKQEKEIQTLQEETKKVQAETASKTREVQAQLLQEKRLLEKQLSEPDRRLLGKRKRRELNMKAQALKLAAKRFIFEYSCGINRENQQFKKELLQLIEQAQKLTATQSHLENRKQQLQQEQWYLESLIQARQRLQGSHNQCLNRQDVPKTTPSLPQGTKSRINPK
-
Molecular Weight
59.5 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCDC121, a coiled-coil domain-containing protein, has garnered significant interest in recent years due to its potential implications in various cellular processes and diseases. Known for its role in mediating protein-protein interactions, CCDC121 is implicated in the regulation of cilia formation and function, making it crucial for cellular signaling and sensory mechanisms. Dysregulation of CCDC121 has been associated with a range of disorders, including developmental abnormalities and cancer. Studies have shown that CCDC121 interacts with key components of the cellular machinery involved in cytoskeletal organization and cell cycle regulation. Given its pivotal role in maintaining cellular homeostasis, researchers have focused on characterizing the structure and function of CCDC121 through recombinant protein studies. These investigations aim to elucidate its biological roles and interactions at the molecular level. The generation of recombinant CCDC121 allows for detailed analysis using biochemical and biophysical techniques, which could lead to breakthroughs in understanding its contributions to cellular architecture and signaling pathways. Additionally, unraveling the mechanisms by which CCDC121 exerts its effects could provide insights into potential therapeutic targets for related diseases. As research progresses, the study of CCDC121 is poised to enhance our knowledge of fundamental biological processes and their implications in health and disease.
