Analytical Data
-
Gene name
MOG
- Application
-
Alternative Names
MOG；Myelin-oligodendrocyte glycoProtein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q61885
-
Expression Region
29-156aa
-
AA Sequence
GQFRVIGPGYPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKETISEGKVTLRIQNVRFSDEGGYTCFFRDHSYQEEAAMELKVEDPFYWVNPGVLT
-
Molecular Weight
16.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on the MOG (myelin oligodendrocyte glycoprotein) recombinant protein has garnered significant attention in the field of neuroimmunology, primarily due to its crucial role in the pathology of multiple sclerosis (MS) and other demyelinating diseases. MOG is a membrane protein expressed on the surface of oligodendrocytes, the cells responsible for myelin formation in the central nervous system (CNS). In MS, the immune system erroneously targets and attacks myelin, leading to neurodegeneration and a range of neurological symptoms. The recombinant form of MOG is utilized in various studies to investigate its immunogenic properties, understand the mechanisms of immune response activation, and explore potential therapeutic interventions. Researchers have focused on the development of MOG-based vaccination strategies, aiming to induce tolerance and mitigate autoimmunity in susceptible individuals. Furthermore, MOG recombinant protein serves as a valuable tool for the production of monoclonal antibodies and in the creation of animal models for studying MS. These models help elucidate the disease's molecular pathways and test novel treatments. Overall, the study of MOG recombinant protein is essential for advancing our understanding of CNS diseases and potentially developing new strategies for therapy and prevention.
