Analytical Data
-
Gene name
CCBE1
- Application
-
Alternative Names
Full of fluid Protein homolog
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6UXH8
-
Expression Region
1-215aa
-
AA Sequence
MVKAGTCCATCKEFYQMKQTVLQLKQKIALLPNNAADLGKYITGDKVLASNTYLPGPPGLPGGQGPPGSPGPKGSPGFPGMPGPPGQPGPRGSMGPMGPSPDLSHIKQGRRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFDFLLLMLADIRNDITELQEKVFGHRTHSSAEEFPLPQEFPSYPEAMDLGSGDDHPRRTETRDLRAPRDFYP
-
Molecular Weight
49 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCBE1 (Collagen and Calcium Binding EGF Domain 1) is a protein that plays a critical role in the development and maintenance of connective tissues and the vascular system. Research into CCBE1 has gained significant attention due to its association with various congenital disorders, particularly those affecting the lymphatic system, such as hereditary lymphedema. Mutations in the CCBE1 gene have been implicated in impaired lymphangiogenesis, leading to severe clinical manifestations. Understanding the structure and function of the CCBE1 recombinant protein is crucial for elucidating its role in normal physiological processes and disease mechanisms. Recent studies have focused on recombinant expression systems to produce functional CCBE1 protein, allowing researchers to explore its biochemical properties and interactions with other molecules. The insights gained from these studies could pave the way for developing therapeutic strategies targeting CCBE1-related pathologies and improving the management of lymphedema and other connective tissue disorders. Additionally, investigating the protein's potential roles in cell signaling, matrix remodeling, and angiogenesis could expand our understanding of its multifaceted contributions to health and disease. Overall, the study of CCBE1 recombinant protein holds promise for advancing our knowledge of connective tissue biology and the underlying mechanisms of related diseases.
