Cat: PA2000-2768

Recombinant E.coli eltA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    eltA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    eltA;ltpA;Heat-labile enterotoxin A chain

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P06717

  • Expression Region

    19-258aa

  • AA Sequence

    NGDRLYRADSRPPDEIKRSGGLMPRGHNEYFDRGTQMNINLYDHARGTQTGFVRYDDGYVSTSLSLRSAHLAGQSILSGYSTYYIYVIATAPNMFNVNDVLGVYSPHPYEQEVSALGGIPYSQIYGWYRVNFGVIDERLHRNREYRDRYYRNLNIAPAEDGYRLAGFPPDHQAWREEPWIHHAPQGCGNSSRTITGDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRIRDEL

  • Molecular Weight

    32.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The eltA gene, which encodes the heat-labile enterotoxin (LT) A subunit of enterotoxigenic Escherichia coli (ETEC), plays a crucial role in the pathogenesis of diarrheal diseases. ETEC is a significant cause of infant diarrheal illnesses and traveler's diarrhea, particularly in developing countries. The LT toxin, composed of one A subunit and five B subunits, functions by increasing intracellular cAMP levels in intestinal epithelial cells, leading to excessive fluid secretion and diarrhea. Given its potent immunogenic properties, the eltA gene has garnered attention for recombinant protein studies, particularly in the development of vaccines. Researchers have focused on producing recombinant eltA protein using various expression systems to analyze its structure, immunogenicity, and potential as a vaccine candidate. This approach aims to harness the protective immune response against ETEC infections. Furthermore, studying eltA provides insights into toxigenic E. coli's mechanisms and could guide novel therapeutic strategies. Advances in biotechnology have enabled efficient cloning and expression of eltA, facilitating the exploration of its applications in vaccine formulation and immunological research. Overall, investigating recombinant eltA proteins presents valuable opportunities for combating ETEC-related diseases and improving global health outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US