Analytical Data
-
Gene name
eltA
- Application
-
Alternative Names
eltA;ltpA;Heat-labile enterotoxin A chain
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P06717
-
Expression Region
19-258aa
-
AA Sequence
NGDRLYRADSRPPDEIKRSGGLMPRGHNEYFDRGTQMNINLYDHARGTQTGFVRYDDGYVSTSLSLRSAHLAGQSILSGYSTYYIYVIATAPNMFNVNDVLGVYSPHPYEQEVSALGGIPYSQIYGWYRVNFGVIDERLHRNREYRDRYYRNLNIAPAEDGYRLAGFPPDHQAWREEPWIHHAPQGCGNSSRTITGDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRIRDEL
-
Molecular Weight
32.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The eltA gene, which encodes the heat-labile enterotoxin (LT) A subunit of enterotoxigenic Escherichia coli (ETEC), plays a crucial role in the pathogenesis of diarrheal diseases. ETEC is a significant cause of infant diarrheal illnesses and traveler's diarrhea, particularly in developing countries. The LT toxin, composed of one A subunit and five B subunits, functions by increasing intracellular cAMP levels in intestinal epithelial cells, leading to excessive fluid secretion and diarrhea. Given its potent immunogenic properties, the eltA gene has garnered attention for recombinant protein studies, particularly in the development of vaccines. Researchers have focused on producing recombinant eltA protein using various expression systems to analyze its structure, immunogenicity, and potential as a vaccine candidate. This approach aims to harness the protective immune response against ETEC infections. Furthermore, studying eltA provides insights into toxigenic E. coli's mechanisms and could guide novel therapeutic strategies. Advances in biotechnology have enabled efficient cloning and expression of eltA, facilitating the exploration of its applications in vaccine formulation and immunological research. Overall, investigating recombinant eltA proteins presents valuable opportunities for combating ETEC-related diseases and improving global health outcomes.











