Analytical Data
-
Gene name
SLC3A2 / CD98
- Application
-
Alternative Names
SLC3A2 / CD98；
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P08195
-
Expression Region
206-630aa
-
AA Sequence
RAPRCRELPAQKWWHTGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLK VKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVI LDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKD ASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYL SDSGSTGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQL MLFTLPGTPVFSYGDEIGLDAAALPGQPMEAPVMLWDESSFPDIPGAVSA NMTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGDFHAFSAGPGLFSYIR HWDQNERFLVVLNFGDVGLSAGLQASDLPASASLPAKADLLLSTQPGREE GSPLELERLKLEPHEGLLLRFPYAAVDHHHHHH
-
Molecular Weight
48 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC3A2, also known as CD98, is a critical transmembrane protein that plays a pivotal role in amino acid transport, cell adhesion, and signaling pathways. As a member of the solute carrier (SLC) family, CD98 primarily functions as a transporter for large neutral amino acids, facilitating their uptake into cells, which is essential for various cellular processes, including protein synthesis and cell proliferation. Dysregulation of CD98 has been implicated in several pathological conditions, including cancer, where it contributes to tumor growth and metastasis by enhancing amino acid availability to rapidly proliferating cells. Research into the recombinant protein expression of SLC3A2/CD98 has gained momentum due to its potential as a therapeutic target and biomarker in cancer and metabolic disorders. Understanding the structure and function of CD98 at a molecular level could provide insights into its role in disease progression and offer avenues for the development of novel therapeutic strategies. Recent studies have focused on characterizing the protein's interactions with other cellular components, as well as its regulatory mechanisms, to elucidate its contribution to homeostasis and disease. Furthermore, recombinant CD98 can be utilized in various applications, including functional assays and drug screening, making it a significant focus of investigation in translational research. As such, the study of SLC3A2/CD98 is not only important for basic science but also holds promise for clinical applications in understanding and treating complex diseases.
