Analytical Data
-
Gene name
CBLN4
- Application
-
Alternative Names
CBLN4; CBLNL1; UNQ718/PRO1382; Cerebellin-4; Cerebellin-like glycoProtein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NTU7
-
Expression Region
1-201aa
-
AA Sequence
MGSGRRALSAVPAVLLVLTLPGLPVWAQNDTEPIVLEGKCLVVCDSNPATDSKGSSSSPLGISVRAANSKVAFSAVRSTNHEPSEMSNKTRIIYFDQILVNVGNFFTLESVFVAPRKGIYSFSFHVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDKVYLKLEKGNLVGGWQYSTFSGFLVFPL
-
Molecular Weight
48.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CBLN4 (Cerebellin 4) is a member of the cerebellin family of neuropeptides, which play crucial roles in synaptic functions and neuronal signaling. Research into CBLN4 has gained momentum due to its potential implications in neurodevelopmental and neuropsychiatric disorders. Studies suggest that CBLN4 may be involved in synaptic plasticity and the modulation of neurotransmission in the central nervous system. Abnormal expression of this protein has been linked to various conditions, including autism spectrum disorders and other cognitive impairments, indicating its significance in understanding the molecular basis of such diseases. Additionally, CBLN4's ability to interact with specific receptors and other synaptic proteins makes it a promising candidate for therapeutic interventions. Furthermore, efforts to produce recombinant CBLN4 proteins have advanced our understanding of its structure and function, facilitating in vitro and in vivo studies that explore its mechanisms of action. Given the increasing prevalence of neuropsychiatric disorders, characterizing CBLN4's role within neural networks could unveil novel therapeutic strategies, highlighting the importance of ongoing research in this area.
