Analytical Data
-
Gene name
BALF5
- Application
-
Alternative Names
BALF5；HLA class II histocompatibility antigen. DR beta 5 chain
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P03198
-
Expression Region
1-210aa
-
AA Sequence
MSGGLFYNPFLRPNKGLLKKPDKEYLRLIPKCFQTPGAAGVVDVRGPQPPLCFYQDSLTVVGGDEDGKGMWWRQRAQEGTARPEADTHGSPLDFHVYDILETVYTHEKCAVIPSDKQGYVVPCGIVIKLLGRRKADGASVCVNVFGQQAYFYASAPQGLDVEFAVLSALKASTFDRRTPCRVSVEKVTRRSIMGYGNHAGDYHKITLSHP
-
Molecular Weight
39.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BALF5 is a crucial protein encoded by the baculovirus, a family of large double-stranded DNA viruses, primarily known for their ability to infect insect cells. This protein is an essential component of the viral replication machinery, specifically serving as a DNA polymerase responsible for synthesizing viral DNA during the replication cycle. The study of BALF5 has garnered significant interest due to its potential applications in biotechnology and virology. Understanding the structure and function of BALF5 can provide insights into viral mechanisms of replication and pathogenesis, which may lead to the development of new antiviral strategies and therapies. Moreover, BALF5 exhibits a unique ability to function efficiently in non-native hosts, making it a candidate for use in gene therapy and recombinant protein production. Research efforts typically focus on characterizing its enzymatic properties, studying its interactions with other viral and host proteins, and exploring its potential as a biotechnological tool. Overall, BALF5 represents a fascinating subject of investigation with implications in both fundamental virology and applied sciences.
