Analytical Data
-
Gene name
emm5
- Application
-
Alternative Names
emm5；smp5；M Protein. serotype 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P02977
-
Expression Region
43-461aa
-
AA Sequence
AVTRGTINDPQRAKEALDKYELENHDLKTKNEGLKTENEGLKTENEGLKTENEGLKTEKKEHEAENDKLKQQRDTLSTQKETLEREVQNTQYNNETLKIKNGDLTKELNKTRQELANKQQESKENEKALNELLEKTVKDKIAKEQENKETIGTLKKILDETVKDKIAKEQENKETIGTLKKILDETVKDKLAKEQKSKQNIGALKQELAKKDEANKISDASRKGLRRDLDASREAKKQLEAEHQKLEEQNKISEASRKGLRRDLDASREAKKQLEAEQQKLEEQNKISEASRKGLRRDLDASREAKKQVEKALEEANSKLAALEKLNKELEESKKLTEKEKAELQAKLEAEAKALKEQLAKQAEELAKLRAGKASDSQTPDTKPGNKAVPGKGQAPQAGTKPNQNKAPMKETKRQLPST
-
Molecular Weight
52.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EMM5, a member of the early membrane protein family, has garnered significant attention in the field of molecular biology due to its crucial role in various cellular processes. This protein is primarily associated with the regulation of immune responses and cellular signaling, making it a key area of research in understanding host-pathogen interactions and potential therapeutic targets. The study of EMM5 has evolved alongside advancements in protein engineering and recombinant DNA technology, facilitating the production of this protein for in-depth functional analysis. Researchers aim to elucidate the mechanisms by which EMM5 influences immune cell activation and its interactions with other signaling molecules. The implications of EMM5 research extend to the development of novel vaccines and immunotherapies, particularly in addressing infectious diseases and autoimmune disorders. Furthermore, structural studies of EMM5 can provide insights into its functional domains and the effects of mutations on its activity, thereby contributing to our understanding of disease pathology. As the quest for effective medical interventions continues, the investigation of EMM5 and its associated pathways remains integral to innovating therapeutic strategies in immunology and beyond.
