Cat: PA2000-2741

Recombinant Mouse Ins1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Ins1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Ins1;Ins-1;Insulin-1

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P01325

  • Expression Region

    25-108aa

  • AA Sequence

    FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN

  • Molecular Weight

    16.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Ins1, or insulin 1, is a critical peptide hormone involved in glucose metabolism, produced primarily by pancreatic beta cells. It plays a vital role in maintaining blood sugar levels and is a key factor in the pathology of diabetes mellitus. Research into recombinant Ins1 protein has gained substantial attention due to its potential therapeutic applications, particularly for diabetes management. Understanding and producing this protein in a recombinant form allows for the investigation of its structural and functional characteristics, enabling the development of insulin analogs that may offer advantages over traditional insulin therapies. The recombinant technology used to produce Ins1 facilitates large-scale production and purification, thereby ensuring consistent quality and bioactivity. Additionally, exploring the role of Ins1 in metabolic pathways can provide insights into diabetes progression and complications. Enhancing our knowledge of Ins1 not only contributes to the understanding of beta-cell function but also paves the way for innovative treatments that could significantly improve patient outcomes in diabetes care. As we continue to unravel the complexities of Ins1, ongoing research aims to leverage its biological properties to develop novel therapeutic strategies that could transform the landscape of diabetes treatment.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US