Analytical Data
-
Gene name
Ins1
- Application
-
Alternative Names
Ins1；Ins-1；Insulin-1
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01325
-
Expression Region
25-108aa
-
AA Sequence
FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN
-
Molecular Weight
16.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Ins1, or insulin 1, is a critical peptide hormone involved in glucose metabolism, produced primarily by pancreatic beta cells. It plays a vital role in maintaining blood sugar levels and is a key factor in the pathology of diabetes mellitus. Research into recombinant Ins1 protein has gained substantial attention due to its potential therapeutic applications, particularly for diabetes management. Understanding and producing this protein in a recombinant form allows for the investigation of its structural and functional characteristics, enabling the development of insulin analogs that may offer advantages over traditional insulin therapies. The recombinant technology used to produce Ins1 facilitates large-scale production and purification, thereby ensuring consistent quality and bioactivity. Additionally, exploring the role of Ins1 in metabolic pathways can provide insights into diabetes progression and complications. Enhancing our knowledge of Ins1 not only contributes to the understanding of beta-cell function but also paves the way for innovative treatments that could significantly improve patient outcomes in diabetes care. As we continue to unravel the complexities of Ins1, ongoing research aims to leverage its biological properties to develop novel therapeutic strategies that could transform the landscape of diabetes treatment.
