Cat: PA2000-2734

Recombinant Human GNAS Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GNAS

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GNAS;GNAS1;Neuroendocrine secretory Protein 55

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P63092

  • Expression Region

    1-394aa

  • AA Sequence

    MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGE SGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLK EAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHA KALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRC RVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVAS SSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEK VLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRIST ASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL

  • Molecular Weight

    45.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GNAS, or Gs alpha subunit, is a critical component of the G protein-coupled receptor signaling pathways, playing a pivotal role in the transduction of extracellular signals into intracellular responses. Mutations or alterations in the GNAS gene have been implicated in various diseases, most notably, endocrine disorders such as pseudohypoparathyroidism and McCune-Albright syndrome. These conditions arise due to abnormal signaling resulting from dysfunctional GNAS proteins. Research into GNAS recombinant proteins focuses on understanding the structural and functional consequences of these mutations, providing insights into the underlying mechanisms of disease. Moreover, the production of recombinant GNAS proteins allows for the development of targeted therapeutic strategies and the exploration of GNAS interactions within signaling networks. The study of GNAS also extends to its involvement in tumorigenesis, where aberrant signaling may contribute to cancer progression. Hence, investigating GNAS recombinant proteins is essential for advancing our knowledge of signal transduction and developing novel treatment approaches for GNAS-related diseases. This area of research continues to grow, driven by the necessity to elucidate the complexities of G protein signaling and its implications in human health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US