Analytical Data
-
Gene name
TAPBP
- Application
-
Alternative Names
TAPBP；NGS17；TAPA；Tapasin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15533
-
Expression Region
197-300aa
-
AA Sequence
PGPPPFGLEWRRQHLGKGHLLLAATPGLNGQMPAAQEGAVAFAAWDDDEP WGPWTGNGTFWLPTVQPFQEGTYLATIHLPYLQGQVTLELAVYKPPKVSL MPAT
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TAPBP (TAP-binding protein) is an important regulator in the immune response, particularly in the presentation of antigens by Major Histocompatibility Complex (MHC) class I molecules. It plays a crucial role in the peptide-loading process, assisting in the stabilization of MHC class I molecules and ensuring that high-affinity peptides are presented to CD8+ T cells, essential for effective cytotoxic responses. Understanding the structure and function of TAPBP and its interactions with both MHC class I and transporter associated with antigen processing (TAP) is critical for delineating the mechanisms underlying immune recognition and response. Research into TAPBP recombinantly produced proteins has garnered interest not only for its fundamental biological relevance but also for potential therapeutic applications. For instance, TAPBP may serve as a target for vaccine development or immunotherapy strategies aimed at enhancing anti-tumor or anti-viral immune responses. Furthermore, abnormalities in TAPBP expression or function have been linked to various pathologies, including cancer and infectious diseases, making it a focal point for understanding immune evasion by tumors and pathogens. Recombinant TAPBP proteins can be used in various assays and studies to elucidate its role in immune regulation, further contributing to the development of innovative approaches in immunotherapy and vaccine design. Through these studies, researchers aim to harness the molecular mechanisms of TAPBP to enhance immune system efficacy, providing avenues for novel therapeutic interventions in diseases characterized by impaired immune function.
