Analytical Data
-
Gene name
FRZB
- Application
-
Alternative Names
FRZB；FIZ；FRE；FRP；Secreted frizzled-related Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92765
-
Expression Region
33-325aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSAACEPVRIPLCKSLPWNMTKMPNHLHH STQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCK SVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGA DFPMDSSNGNCRGASSERCKCKPIRATQKTYFRNNYNYVIRAKVKEIKTK CHDVTAVVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGY EDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLSKSDSSNSDST QSQKSGRNSNPRQARN
-
Molecular Weight
35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FRZB, or Frizzled-related protein, is a member of the secreted Frizzled-related proteins (sFRPs) family, which play a critical role in the regulation of the Wnt signaling pathway, a pivotal pathway involved in cell proliferation, differentiation, and embryonic development. Research into FRZB has gained prominence due to its potential implications in various diseases, particularly in cancer and skeletal disorders. Aberrant Wnt signaling has been linked to tumorigenesis, making FRZB a focal point for understanding cancer biology and developing therapeutic strategies. Additionally, FRZB has been associated with bone formation and repair, as well as conditions like osteoarthritis and osteoporosis. The ability of FRZB to modulate Wnt signaling presents an intriguing avenue for research, as it may serve as a biomarker for disease progression or a target for novel interventions. Studies exploring the structure, function, and regulatory mechanisms of FRZB are essential for unraveling its role in health and disease, providing insights into its potential utility in clinical applications. Overall, the investigation of FRZB encompasses a multidisciplinary approach, integrating molecular biology, genetics, and therapeutic development to elucidate its significance in both developmental biology and pathology.
